PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G018589_P01
Common NameMADS41, Zm.14825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30101.9 Da    PI: 9.3506
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G018589_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.87.8e-30959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a+i+fs++g+lyeyss
  GRMZM2G018589_P01  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALIVFSTRGRLYEYSS 59
                       79***********************************************96 PP

2K-box104.81.1e-34831749100
              K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                        ++ +  ++ qqe+akL+++i++Lq+++Rhl+Ge+ ++++ keL+ Le++Le+++ +iRskK+elll++ie++qk+e +l++en+ Lr+k++e
  GRMZM2G018589_P01  83 TDVNSLQYFQQEAAKLRQQIQTLQNSNRHLMGESTGNMTAKELKGLESRLERGIGRIRSKKHELLLAEIEYMQKREADLHNENMFLRAKVAE 174
                        4556789**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
CDDcd002656.36E-46275No hitNo description
SuperFamilySSF554552.88E-32274IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.78688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0001007developmental stagepollen development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALIVFST RGRLYEYSSN  60
SVRSTIERYK KASASTSGTA PVTDVNSLQY FQQEAAKLRQ QIQTLQNSNR HLMGESTGNM  120
TAKELKGLES RLERGIGRIR SKKHELLLAE IEYMQKREAD LHNENMFLRA KVAEAERALE  180
QEAAEDQTMM VPAAVRGATT ELKALPASFD ASGYYQYQQH QHVVAAASAA SSSQYAEQPQ  240
GQQEYHHQTA LHLGYHVKID SAADKGFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-20173173Myocyte-specific enhancer factor 2B
1tqe_R3e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-20173173Myocyte-specific enhancer factor 2B
1tqe_P3e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G018589
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G018589_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621100.0BT062110.1 Zea mays full-length cDNA clone ZM_BFb0215E12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674724.10.0PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-130MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLC0HIF40.0C0HIF4_MAIZE; MADS transcription factor
STRINGGRMZM2G018589_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-91MIKC_MADS family protein